Lineage for d1lfha1 (1lfh A:1-334)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1186196Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 1186197Protein Lactoferrin [53889] (6 species)
  7. 1186272Species Human (Homo sapiens) [TaxId:9606] [53890] (22 PDB entries)
  8. 1186302Domain d1lfha1: 1lfh A:1-334 [35856]
    complexed with cl

Details for d1lfha1

PDB Entry: 1lfh (more details), 2.8 Å

PDB Description: molecular replacement solution of the structure of apolactoferrin, a protein displaying large-scale conformational change
PDB Compounds: (A:) lactoferrin

SCOPe Domain Sequences for d1lfha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lfha1 c.94.1.2 (A:1-334) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]}
grrrsvqwcavsnpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtld
ggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglr
rtagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenk
cafssqepyfsysgafkclkdgagdvafirestvfedlsdeaerdeyellcpdntrkpvd
kfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllf
kdsaigfsrvppridsglylgsgyftaiqnlrks

SCOPe Domain Coordinates for d1lfha1:

Click to download the PDB-style file with coordinates for d1lfha1.
(The format of our PDB-style files is described here.)

Timeline for d1lfha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lfha2