SCOP 1.65: Domain d1lfg_1: 1lfg 1-334

Lineage for d1lfg_1 (1lfg 1-334)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (3 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53890] (20 PDB entries)

8. Domain d1lfg_1: 1lfg 1-334 [35845]

Details for d1lfg_1

PDB Entry: 1lfg, 2.2 Å

PDB Description: structure of diferric human lactoferrin

SCOP Domain Sequences for d1lfg_1:

Sequence; same for both SEQRES and ATOM records:

>d1lfg_1 c.94.1.2 (1-334) Lactoferrin {Human (Homo sapiens)}
grrrsvqwcavsnpeatkcfqwqrnmrkvrgppvscikrdspiqciqaiaenradavtld
ggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglr
rtagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenk
cafssqepyfsysgafkclkdgagdvafirestvfedlsdeaerdeyellcpdntrkpvd
kfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllf
kdsaigfsrvppridsglylgsgyftaiqnlrks

Timeline for d1lfg_1:

• d1lfg_1 first appeared (with stable ids) in SCOP 1.55
  
• d1lfg_1 appears in SCOP 1.63
  
• d1lfg_1 appears in SCOP 1.67
  
• d1lfg_1 appears in the current release, SCOPe 2.08, called d1lfga1