Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Paenibacillus macerans [TaxId:44252] [256322] (4 PDB entries) |
Domain d6aija2: 6aij A:408-497 [358422] Other proteins in same PDB: d6aija1, d6aija3, d6aija4 automated match to d4jcla2 complexed with ca; mutant |
PDB Entry: 6aij (more details), 2.1 Å
SCOPe Domain Sequences for d6aija2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aija2 b.71.1.0 (A:408-497) automated matches {Paenibacillus macerans [TaxId: 44252]} gttterwvnndvliierkfgssaalvainrnssaaypisgllsslpagtysdvlngllng nsitvgsggavtnftlaaggtavwqytape
Timeline for d6aija2: