Lineage for d6aija2 (6aij A:408-497)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811146Species Paenibacillus macerans [TaxId:44252] [256322] (4 PDB entries)
  8. 2811150Domain d6aija2: 6aij A:408-497 [358422]
    Other proteins in same PDB: d6aija1, d6aija3, d6aija4
    automated match to d4jcla2
    complexed with ca; mutant

Details for d6aija2

PDB Entry: 6aij (more details), 2.1 Å

PDB Description: cyclodextrin glycosyltransferase from paenibacillus macerans mutant n603d
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d6aija2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aija2 b.71.1.0 (A:408-497) automated matches {Paenibacillus macerans [TaxId: 44252]}
gttterwvnndvliierkfgssaalvainrnssaaypisgllsslpagtysdvlngllng
nsitvgsggavtnftlaaggtavwqytape

SCOPe Domain Coordinates for d6aija2:

Click to download the PDB-style file with coordinates for d6aija2.
(The format of our PDB-style files is described here.)

Timeline for d6aija2: