SCOP 1.65: Domain d1eh3a_: 1eh3 A:

Lineage for d1eh3a_ (1eh3 A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (3 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53890] (20 PDB entries)

8. Domain d1eh3a_: 1eh3 A: [35842]
   N-terminal lobe
   complexed with co3, fe; mutant

Details for d1eh3a_

PDB Entry: 1eh3, 2 Å

PDB Description: r210k n-terminal lobe human lactoferrin

SCOP Domain Sequences for d1eh3a_:

Sequence; same for both SEQRES and ATOM records:

>d1eh3a_ c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens)}
rsvqwcavsqpeatkcfqwqrnmrrvrgppvscikrdspiqciqaiaenradavtldggf
iyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglrrta
gwnvpigtlrpfldwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkcaf
ssqepyfsysgafkclrdgagdvafikestvfedlsdeaerdeyellcpdntrkpvdkfk
dchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfkds
aigfsrvppridsglylgsgyfta

Timeline for d1eh3a_:

• d1eh3a_ first appeared (with stable ids) in SCOP 1.55
  
• d1eh3a_ appears in SCOP 1.63
  
• d1eh3a_ appears in SCOP 1.67
  
• d1eh3a_ appears in the current release, SCOPe 2.08