SCOPe 2.08: Domain d6gqsa1: 6gqs A:1-227

Lineage for d6gqsa1 (6gqs A:1-227)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein HSP90 [55876] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries)
   Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223

8. Domain d6gqsa1: 6gqs A:1-227 [358338]
   Other proteins in same PDB: d6gqsa2
   automated match to d4egia_
   complexed with a12, mg

Details for d6gqsa1

PDB Entry: 6gqs, 1.43 Å

PDB Description: structure of human heat shock protein 90-alpha n-terminal domain (hsp90-ntd) variant k112r in complex with ampcp

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d6gqsa1:

Sequence; same for both SEQRES and ATOM records:

>d6gqsa1 d.122.1.1 (A:1-227) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
mpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkir
yesltdpskldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiarsgtkafme
alqagadismigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepm
grgtkvilhlkedqteyleerrikeivkkhsqfigypitlfvekerd

Timeline for d6gqsa1:

• d6gqsa1 first appeared in SCOPe 2.07