Lineage for d1amf__ (1amf -)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) 
Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins) 
Protein Molybdate-binding protein, ModA [53883] (2 species) 
Species Escherichia coli [TaxId:562] [53884] (2 PDB entries) 
Domain d1amf__: 1amf - [35833]
Details for d1amf__
PDB Entry: 1amf (more details), 1.75 Å
PDB Description: crystal structure of moda, a molybdate transport protein, complexed with molybdate
SCOP Domain Sequences for d1amf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1amf__ c.94.1.1 (-) Molybdate-binding protein, ModA {Escherichia coli}
gkitvfaaasltnamqdiatqfkkekgvdvvssfassstlarqieagapadlfisadqkw
mdyavdkkaidtatrqtllgnslvvvapkasvqkdftidsktnwtsllnggrlavgdpeh
vpagiyakealqklgawdtlspklapaedvrgalalverneaplgivygsdavaskgvkv
vatfpedshkkveypvavveghnnatvkafydylkgpqaaeifkrygftik
SCOP Domain Coordinates for d1amf__:
Click to download the PDB-style file with coordinates for d1amf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1amf__:
- d1amf__ first appeared (with stable ids) in SCOP 1.55
- d1amf__ appears in SCOP 1.57
- d1amf__ appears in SCOP 1.61
- d1amf__ appears in the current release, SCOPe 2.08, called d1amfa_
View in 3D