Lineage for d1fw0a_ (1fw0 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128115Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 128116Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 128117Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins)
  6. 128173Protein Glutamate receptor ligand binding core [53881] (2 species)
  7. 128174Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (7 PDB entries)
  8. 128187Domain d1fw0a_: 1fw0 A: [35831]

Details for d1fw0a_

PDB Entry: 1fw0 (more details), 1.9 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with kainate at 2.0 a resolution

SCOP Domain Sequences for d1fw0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fw0a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOP Domain Coordinates for d1fw0a_:

Click to download the PDB-style file with coordinates for d1fw0a_.
(The format of our PDB-style files is described here.)

Timeline for d1fw0a_: