SCOP 1.61: Domain d1ftlb_: 1ftl B:

Lineage for d1ftlb_ (1ftl B:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)

5. Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (2 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (11 PDB entries)

8. Domain d1ftlb_: 1ftl B: [35824]

Details for d1ftlb_

PDB Entry: 1ftl, 1.8 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with the antagonist dnqx at 1.8 a resolution

SCOP Domain Sequences for d1ftlb_:

Sequence; same for both SEQRES and ATOM records:

>d1ftlb_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
tvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkygar
dadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpiesa
edlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrks
kgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklneq
glldklknkwwydkgec

Timeline for d1ftlb_:

• d1ftlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ftlb_ appears in SCOP 1.59
  
• d1ftlb_ appears in SCOP 1.63
  
• d1ftlb_ appears in the current release, SCOPe 2.08