Lineage for d1ftmc_ (1ftm C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186247Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 186248Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 186249Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins)
  6. 186305Protein Glutamate receptor ligand binding core [53881] (2 species)
  7. 186306Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (11 PDB entries)
  8. 186310Domain d1ftmc_: 1ftm C: [35822]

Details for d1ftmc_

PDB Entry: 1ftm (more details), 1.7 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with ampa at 1.7 resolution

SCOP Domain Sequences for d1ftmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftmc_ c.94.1.1 (C:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOP Domain Coordinates for d1ftmc_:

Click to download the PDB-style file with coordinates for d1ftmc_.
(The format of our PDB-style files is described here.)

Timeline for d1ftmc_: