SCOP 1.61: Domain d1ggga_: 1ggg A:

Lineage for d1ggga_ (1ggg A:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)

5. Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins)

6. Protein Glutamine-binding protein [53879] (1 species)

7. Species Escherichia coli [TaxId:562] [53880] (2 PDB entries)

8. Domain d1ggga_: 1ggg A: [35817]

Details for d1ggga_

PDB Entry: 1ggg, 2.3 Å

PDB Description: glutamine binding protein open ligand-free structure

SCOP Domain Sequences for d1ggga_:

Sequence; same for both SEQRES and ATOM records:

>d1ggga_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli}
lvvatdtafvpfefkqgdlyvgfdvdlwaaiakelkldyelkpmdfsgiipalqtknvdl
alagititderkkaidfsdgyyksgllvmvkannndvksvkdldgkvvavksgtgsvdya
kaniktkdlrqfpnidnaymelgtnradavlhdtpnilyfiktagngqfkavgdsleaqq
ygiafpkgsdelrdkvngalktlrengtyneiykkwfgte

Timeline for d1ggga_:

• d1ggga_ first appeared (with stable ids) in SCOP 1.55
  
• d1ggga_ appears in SCOP 1.59
  
• d1ggga_ appears in SCOP 1.63
  
• d1ggga_ appears in the current release, SCOPe 2.08