Lineage for d6mfma2 (6mfm A:137-305)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584675Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2584676Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2584750Family d.139.1.0: automated matches [227182] (1 protein)
    not a true family
  6. 2584751Protein automated matches [226902] (12 species)
    not a true protein
  7. 2584752Species Acinetobacter baumannii [TaxId:470] [276304] (4 PDB entries)
  8. 2584759Domain d6mfma2: 6mfm A:137-305 [358083]
    Other proteins in same PDB: d6mfma1, d6mfmb1
    automated match to d5cm7a2
    complexed with adp, mg, na, tpp

Details for d6mfma2

PDB Entry: 6mfm (more details), 1.9 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form
PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d6mfma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mfma2 d.139.1.0 (A:137-305) automated matches {Acinetobacter baumannii [TaxId: 470]}
tgkavlrsgakvgdyvcvsgqigdaayglqhlghslqqrldyptprcklgeelkglassm
idvsdglaqdlghilkaskvgarlileklpvdpvlqqieeqqrwqyalaggddyelcfti
tpqnyekllqkqldvkitmigqiveqtkltfehlgsdyplqihgyqhfa

SCOPe Domain Coordinates for d6mfma2:

Click to download the PDB-style file with coordinates for d6mfma2.
(The format of our PDB-style files is described here.)

Timeline for d6mfma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6mfma1