SCOPe 2.08: Domain d6hkgd2: 6hkg D:109-181

Lineage for d6hkgd2 (6hkg D:109-181)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6hkgd2: 6hkg D:109-181 [358062]
   Other proteins in same PDB: d6hkga_, d6hkgb2, d6hkgc_
   automated match to d4jqil2
   complexed with so4

Details for d6hkgd2

PDB Entry: 6hkg, 1.87 Å

PDB Description: structure of fisw84 fab fragment

PDB Compounds: (D:) FISW84 Fab Fragment Light Chain

SCOPe Domain Sequences for d6hkgd2:

Sequence; same for both SEQRES and ATOM records:

>d6hkgd2 b.1.1.0 (D:109-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifpptasvvcllnnfyprensqesvteqdskdstyslsstlt

Timeline for d6hkgd2:

• d6hkgd2 first appeared in SCOPe 2.07