SCOPe 2.08: Domain d6hkgb2: 6hkg B:108-214

Lineage for d6hkgb2 (6hkg B:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6hkgb2: 6hkg B:108-214 [358058]
   Other proteins in same PDB: d6hkga_, d6hkgb1, d6hkgc_, d6hkgd1, d6hkgd2
   automated match to d3cfja2
   complexed with so4

Details for d6hkgb2

PDB Entry: 6hkg, 1.87 Å

PDB Description: structure of fisw84 fab fragment

PDB Compounds: (B:) FISW84 Fab Fragment Light Chain

SCOPe Domain Sequences for d6hkgb2:

Sequence; same for both SEQRES and ATOM records:

>d6hkgb2 b.1.1.2 (B:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6hkgb2:

• d6hkgb2 first appeared in SCOPe 2.07