SCOPe 2.07: Domain d6dxsb1: 6dxs B:2-341

Lineage for d6dxsb1 (6dxs B:2-341)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (34 species)
   not a true protein

7. Species Sphingobium sp. [TaxId:627192] [339663] (5 PDB entries)

8. Domain d6dxsb1: 6dxs B:2-341 [358043]
   Other proteins in same PDB: d6dxsa2, d6dxsb2, d6dxsc2, d6dxsd2
   automated match to d4ofca_
   complexed with hj7, zn; mutant

Details for d6dxsb1

PDB Entry: 6dxs, 1.65 Å

PDB Description: crystal structure of the ligj hydratase e284q mutant substrate complex with (3z)-2-keto-4-carboxy-3-hexenedioate

PDB Compounds: (B:) 4-oxalomesaconate hydratase

SCOPe Domain Sequences for d6dxsb1:

Sequence; same for both SEQRES and ATOM records:

>d6dxsb1 c.1.9.0 (B:2-341) automated matches {Sphingobium sp. [TaxId: 627192]}
mmiidchghytvlpkahdewreqqkaafkagqpappypeisddeiretieanqlrliker
gadmtifsprasamaphvgdqsvavpwaqacnnliarvvdlfpetfagvcmlpqspeadm
tssiaelercvnelgfigcnlnpdpggghfkhppltdrfwypfyekmveldvpamihvsg
scnpamhatgayylaadtiafmqllqgnlfadfptlrfiiphgggavpyhwgrfrgladm
lkqpsldtllmnnvffdtcvyhqpginlladvidnknilfgsqmvgavrgidpttghyfd
dtkryidaldisdqerhaifegntrrvfprldaklkargl

Timeline for d6dxsb1:

• d6dxsb1 is new in SCOPe 2.07-stable
  
• d6dxsb1 appears in the current release, SCOPe 2.08