SCOP 1.59: Domain d1hsla_: 1hsl A:

Lineage for d1hsla_ (1hsl A:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)

5. Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins)

6. Protein Histidine-binding protein [53872] (2 species)

7. Species Escherichia coli [TaxId:562] [53873] (1 PDB entry)

8. Domain d1hsla_: 1hsl A: [35804]

Details for d1hsla_

PDB Entry: 1hsl, 1.89 Å

PDB Description: refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors

SCOP Domain Sequences for d1hsla_:

Sequence; same for both SEQRES and ATOM records:

>d1hsla_ c.94.1.1 (A:) Histidine-binding protein {Escherichia coli}
aipqkirigtdptyapfesknaqgelvgfdidlakelckrintqctfvenpldalipslk
akkidaimsslsitekrqqeiaftdklyaadsrlvvaknsdiqptvaslkgkrvgvlqgt
tqetfgnehwapkgieivsyqgqdniysdltagridaafqdevaasegflkqpvgkdykf
ggpavkdeklfgvgtgmglrkednelrealnkafaemradgtyeklakkyfdfdvygg

Timeline for d1hsla_:

• d1hsla_ first appeared (with stable ids) in SCOP 1.55
  
• d1hsla_ appears in SCOP 1.57
  
• d1hsla_ appears in SCOP 1.61
  
• d1hsla_ appears in the current release, SCOPe 2.08