Lineage for d1hsla_ (1hsl A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128115Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 128116Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 128117Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins)
  6. 128197Protein Histidine-binding protein [53872] (2 species)
  7. 128198Species Escherichia coli [TaxId:562] [53873] (1 PDB entry)
  8. 128199Domain d1hsla_: 1hsl A: [35804]

Details for d1hsla_

PDB Entry: 1hsl (more details), 1.89 Å

PDB Description: refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors

SCOP Domain Sequences for d1hsla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsla_ c.94.1.1 (A:) Histidine-binding protein {Escherichia coli}
aipqkirigtdptyapfesknaqgelvgfdidlakelckrintqctfvenpldalipslk
akkidaimsslsitekrqqeiaftdklyaadsrlvvaknsdiqptvaslkgkrvgvlqgt
tqetfgnehwapkgieivsyqgqdniysdltagridaafqdevaasegflkqpvgkdykf
ggpavkdeklfgvgtgmglrkednelrealnkafaemradgtyeklakkyfdfdvygg

SCOP Domain Coordinates for d1hsla_:

Click to download the PDB-style file with coordinates for d1hsla_.
(The format of our PDB-style files is described here.)

Timeline for d1hsla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hslb_