Lineage for d1d9ya_ (1d9y A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494730Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 494731Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 494732Family c.94.1.1: Phosphate binding protein-like [53851] (28 proteins)
  6. 494818Protein Ferric-binding protein FbpA [53867] (3 species)
  7. 494829Species Neisseria gonorrhoeae [53869] (4 PDB entries)
  8. 494857Domain d1d9ya_: 1d9y A: [35798]

Details for d1d9ya_

PDB Entry: 1d9y (more details), 2.2 Å

PDB Description: neisseria gonorrhoeae ferric binding protein

SCOP Domain Sequences for d1d9ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9ya_ c.94.1.1 (A:) Ferric-binding protein FbpA {Neisseria gonorrhoeae}
ditvyngqhkeaaqavadaftratgikvklncakgdqlagqikeegsrspadvfyseqip
alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
rlleqagmk

SCOP Domain Coordinates for d1d9ya_:

Click to download the PDB-style file with coordinates for d1d9ya_.
(The format of our PDB-style files is described here.)

Timeline for d1d9ya_: