Lineage for d6gqqa_ (6gqq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983234Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2983235Species Human (Homo sapiens) [TaxId:9606] [56161] (30 PDB entries)
  8. 2983238Domain d6gqqa_: 6gqq A: [357914]
    automated match to d4agda_
    complexed with f8b

Details for d6gqqa_

PDB Entry: 6gqq (more details), 1.52 Å

PDB Description: crystal structure of human kdr (vegfr2) kinase domain in complex with azd3229-analogue (compound 35)
PDB Compounds: (A:) Vascular endothelial growth factor receptor 2

SCOPe Domain Sequences for d6gqqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gqqa_ d.144.1.7 (A:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
ldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlke
gathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskr
nefvpykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvv
kicdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslg
aspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgn
llqan

SCOPe Domain Coordinates for d6gqqa_:

Click to download the PDB-style file with coordinates for d6gqqa_.
(The format of our PDB-style files is described here.)

Timeline for d6gqqa_: