PDB entry 6gqq

View 6gqq on RCSB PDB site
Description: Crystal structure of human KDR (VEGFR2) kinase domain in complex with AZD3229-analogue (compound 35)
Class: signaling protein
Keywords: receptor tyrosine kinase, inhibitor, oncology, gastrointestinal stromal tumour, structure-based drug design, SIGNALING PROTEIN
Deposited on 2018-06-07, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KDR, FLK1, VEGFR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35968 (Start-133)
      • linker (134)
    • Uniprot P35968 (135-End)
    Domains in SCOPe 2.07: d6gqqa_
  • Heterogens: F8B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6gqqA (A:)
    mdpdelpldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtv
    avkmlkegathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnls
    tylrskrnefvpykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnil
    lseknvvkicdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvll
    weifslgaspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfse
    lvehlgnllqanaqqdenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6gqqA (A:)
    ldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlke
    gathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskr
    nefvpykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvv
    kicdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslg
    aspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgn
    llqan