Lineage for d1a7lc_ (1a7l C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1390578Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1390627Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 1390639Species Escherichia coli [TaxId:562] [53863] (55 PDB entries)
    Uniprot P02928
  8. 1390706Domain d1a7lc_: 1a7l C: [35789]
    insertion/deletion mutant with an inserted B-cell epitope from hepatitis B virus
    complexed with mal

Details for d1a7lc_

PDB Entry: 1a7l (more details), 2.9 Å

PDB Description: dominant b-cell epitope from the pres2 region of hepatitis b virus in the form of an inserted peptide segment in maltodextrin-binding protein
PDB Compounds: (C:) male-b363

SCOPe Domain Sequences for d1a7lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7lc_ c.94.1.1 (C:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
gs

SCOPe Domain Coordinates for d1a7lc_:

Click to download the PDB-style file with coordinates for d1a7lc_.
(The format of our PDB-style files is described here.)

Timeline for d1a7lc_: