Lineage for d1a7lc_ (1a7l C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 28131Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 28132Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 28133Family c.94.1.1: Phosphate binding protein-like [53851] (16 proteins)
  6. 28137Protein D-maltodextrin-binding protein, MBP [53862] (2 species)
  7. 28138Species Escherichia coli [TaxId:562] [53863] (13 PDB entries)
  8. 28153Domain d1a7lc_: 1a7l C: [35789]

Details for d1a7lc_

PDB Entry: 1a7l (more details), 2.9 Å

PDB Description: dominant b-cell epitope from the pres2 region of hepatitis b virus in the form of an inserted peptide segment in maltodextrin-binding protein

SCOP Domain Sequences for d1a7lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7lc_ c.94.1.1 (C:) D-maltodextrin-binding protein, MBP {Escherichia coli}
egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
gs

SCOP Domain Coordinates for d1a7lc_:

Click to download the PDB-style file with coordinates for d1a7lc_.
(The format of our PDB-style files is described here.)

Timeline for d1a7lc_: