Lineage for d1a7lb_ (1a7l B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186247Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 186248Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 186249Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins)
  6. 186256Protein D-maltodextrin-binding protein, MBP [53862] (3 species)
  7. 186261Species Escherichia coli [TaxId:562] [53863] (25 PDB entries)
  8. 186289Domain d1a7lb_: 1a7l B: [35788]

Details for d1a7lb_

PDB Entry: 1a7l (more details), 2.9 Å

PDB Description: dominant b-cell epitope from the pres2 region of hepatitis b virus in the form of an inserted peptide segment in maltodextrin-binding protein

SCOP Domain Sequences for d1a7lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7lb_ c.94.1.1 (B:) D-maltodextrin-binding protein, MBP {Escherichia coli}
egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
nppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
gsqdprvrglyf

SCOP Domain Coordinates for d1a7lb_:

Click to download the PDB-style file with coordinates for d1a7lb_.
(The format of our PDB-style files is described here.)

Timeline for d1a7lb_: