Lineage for d6gv7a_ (6gv7 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642427Fold g.46: Metallothionein [57867] (1 superfamily)
    metal(iron)-bound fold
    duplication: consists of clear structural/sequence repeats
  4. 2642428Superfamily g.46.1: Metallothionein [57868] (2 families) (S)
  5. 2642471Family g.46.1.0: automated matches [357866] (1 protein)
    not a true family
  6. 2642472Protein automated matches [357867] (1 species)
    not a true protein
  7. 2642473Species Pseudomonas fluorescens [TaxId:1038922] [357868] (1 PDB entry)
  8. 2642474Domain d6gv7a_: 6gv7 A: [357869]
    automated match to d1jjda_
    complexed with cd; mutant

Details for d6gv7a_

PDB Entry: 6gv7 (more details)

PDB Description: cadmium(ii) form of a44h mutant of shortened metallothionein from pseudomonas fluorescens q2-87 (residues 1-52)
PDB Compounds: (A:) metallothionein

SCOPe Domain Sequences for d6gv7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gv7a_ g.46.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 1038922]}
nelrcgcpdchckvdpervfnhdgeaycsqacaeqhpngepcphpdchcers

SCOPe Domain Coordinates for d6gv7a_:

Click to download the PDB-style file with coordinates for d6gv7a_.
(The format of our PDB-style files is described here.)

Timeline for d6gv7a_: