Lineage for d5yd7a_ (5yd7 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. Protein automated matches [190079] (12 species)
    not a true protein
  7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (74 PDB entries)
  8. Domain d5yd7a_: 5yd7 A: [357857]
    automated match to d5lsca_
    complexed with fmt, zn

Details for d5yd7a_

PDB Entry: 5yd7 (more details), 1.7000000000000002 Å

PDB Description: crystal structure of vim-2 metallo-beta-lactamase
PDB Compounds: (A:) beta-lactamase class b vim-2

SCOPe Domain Sequences for d5yd7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yd7a_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr

SCOPe Domain Coordinates for d5yd7a_ are not available.

Timeline for d5yd7a_:

Domains from other chains:
(mouse over for more information)
d5yd7b_