Lineage for d1qui__ (1qui -)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128115Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
  4. 128116Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
  5. 128117Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins)
  6. 128256Protein Phosphate-binding protein [53860] (1 species)
  7. 128257Species Escherichia coli [TaxId:562] [53861] (13 PDB entries)
  8. 128266Domain d1qui__: 1qui - [35769]

Details for d1qui__

PDB Entry: 1qui (more details), 1.9 Å

PDB Description: phosphate-binding protein mutant with asp 137 replaced by gly complex with bromine and phosphate

SCOP Domain Sequences for d1qui__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qui__ c.94.1.1 (-) Phosphate-binding protein {Escherichia coli}
easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls
deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
pglklpsqniavvrraggsgtsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
aafvqrlpgaigyveyayakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
veqvraawktnikdssgkply

SCOP Domain Coordinates for d1qui__:

Click to download the PDB-style file with coordinates for d1qui__.
(The format of our PDB-style files is described here.)

Timeline for d1qui__: