SCOP 1.59: Domain d1ixg__: 1ixg -

Lineage for d1ixg__ (1ixg -)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)

5. Family c.94.1.1: Phosphate binding protein-like [53851] (18 proteins)

6. Protein Phosphate-binding protein [53860] (1 species)

7. Species Escherichia coli [TaxId:562] [53861] (13 PDB entries)

8. Domain d1ixg__: 1ixg - [35762]

Details for d1ixg__

PDB Entry: 1ixg, 1.05 Å

PDB Description: phosphate-binding protein mutant with thr 141 replaced by asp (t141d), complexed with phospate

SCOP Domain Sequences for d1ixg__:

Sequence; same for both SEQRES and ATOM records:

>d1ixg__ c.94.1.1 (-) Phosphate-binding protein {Escherichia coli}
easltgagatfpapvyakwadtyqketgnkvnyqgigssggvkqiiantvdfgasdapls
deklaqeglfqfptviggvvlavnipglksgelvldgktlgdiylgkikkwddeaiakln
pglklpsqniavvrradgsgdsfvftsylakvneewknnvgtgstvkwpiglggkgndgi
aafvqrlpgaigyveyayakqnnlaytklisadgkpvspteenfanaakgadwsktfaqd
ltnqkgedawpitsttfilihkdqkkpeqgtevlkffdwayktgakqandldyaslpdsv
veqvraawktnikdssgkply

Timeline for d1ixg__:

• d1ixg__ first appeared (with stable ids) in SCOP 1.55
  
• d1ixg__ appears in SCOP 1.57
  
• d1ixg__ appears in SCOP 1.61
  
• d1ixg__ appears in the current release, SCOPe 2.08, called d1ixga_