SCOPe 2.08: Domain d5naza2: 5naz A:115-229

Lineage for d5naza2 (5naz A:115-229)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
   duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
   automatically mapped to Pfam PF01413

6. Protein automated matches [357567] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [357568] (1 PDB entry)

8. Domain d5naza2: 5naz A:115-229 [357569]
   Other proteins in same PDB: d5naza1
   automated match to d1li1a2
   complexed with cl, pg4

Details for d5naza2

PDB Entry: 5naz, 1.85 Å

PDB Description: crystal structures of homooligomers of collagen type iv. alpha5nc1

PDB Compounds: (A:) Collagen alpha-5(IV) chain

SCOPe Domain Sequences for d5naza2:

Sequence; same for both SEQRES and ATOM records:

>d5naza2 d.169.1.6 (A:115-229) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avviavhsqtiqiphcpqgwdslwigysfmmhtsagaegsgqalaspgscleefrsapfi
echgrgtcnyyansysfwlatvdvsdmfskpqsetlkagdlrtrisrcqvcmkrt

Timeline for d5naza2:

• d5naza2 first appeared in SCOPe 2.07