Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins) duplication: consists of two subdomains of this fold; segment swapping within and between individual domains automatically mapped to Pfam PF01413 |
Protein automated matches [357567] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [357568] (1 PDB entry) |
Domain d5naza2: 5naz A:115-229 [357569] Other proteins in same PDB: d5naza1 automated match to d1li1a2 complexed with cl, pg4 |
PDB Entry: 5naz (more details), 1.85 Å
SCOPe Domain Sequences for d5naza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5naza2 d.169.1.6 (A:115-229) automated matches {Human (Homo sapiens) [TaxId: 9606]} avviavhsqtiqiphcpqgwdslwigysfmmhtsagaegsgqalaspgscleefrsapfi echgrgtcnyyansysfwlatvdvsdmfskpqsetlkagdlrtrisrcqvcmkrt
Timeline for d5naza2: