Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins) |
Protein Oligo-peptide binding protein (OPPA) [53852] (3 species) contains an additional alpha+beta domain inserted in the N-terminal domain |
Species Salmonella typhimurium [TaxId:90371] [53853] (32 PDB entries) |
Domain d1b05a_: 1b05 A: [35745] complexed with ium |
PDB Entry: 1b05 (more details), 2 Å
SCOP Domain Sequences for d1b05a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b05a_ c.94.1.1 (A:) Oligo-peptide binding protein (OPPA) {Salmonella typhimurium [TaxId: 602]} advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh
Timeline for d1b05a_: