SCOP 1.71: Domain d1b6ha_: 1b6h A:

Lineage for d1b6ha_ (1b6h A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (29 proteins)

6. Protein Oligo-peptide binding protein (OPPA) [53852] (1 species)
   contains an additional alpha+beta domain inserted in the N-terminal domain

7. Species Salmonella typhimurium [TaxId:90371] [53853] (32 PDB entries)

8. Domain d1b6ha_: 1b6h A: [35727]
   complexed with ium, nva

Details for d1b6ha_

PDB Entry: 1b6h, 1.8 Å

PDB Description: oligo-peptide binding protein complexed with lysyl-norvalyl-lysine

SCOP Domain Sequences for d1b6ha_:

Sequence; same for both SEQRES and ATOM records:

>d1b6ha_ c.94.1.1 (A:) Oligo-peptide binding protein (OPPA) {Salmonella typhimurium}
advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt
fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady
neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv
pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh

Timeline for d1b6ha_:

• d1b6ha_ first appeared (with stable ids) in SCOP 1.55
  
• d1b6ha_ appears in SCOP 1.69
  
• d1b6ha_ appears in SCOP 1.73
  
• d1b6ha_ appears in the current release, SCOPe 2.08