SCOP 1.69: Domain d1jeva_: 1jev A:

Lineage for d1jeva_ (1jev A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (28 proteins)

6. Protein Oligo-peptide binding protein (OPPA) [53852] (1 species)
   contains an additional alpha+beta domain inserted in the N-terminal domain

7. Species Salmonella typhimurium [TaxId:90371] [53853] (32 PDB entries)

8. Domain d1jeva_: 1jev A: [35720]

Details for d1jeva_

PDB Entry: 1jev, 1.3 Å

PDB Description: oligo-peptide binding protein (oppa) complexed with kwk

SCOP Domain Sequences for d1jeva_:

Sequence; same for both SEQRES and ATOM records:

>d1jeva_ c.94.1.1 (A:) Oligo-peptide binding protein (OPPA) {Salmonella typhimurium}
advpagvqladkqtlvrnngsevqsldphkiegvpesnvsrdlfegllisdveghpspgv
aekwenkdfkvwtfhlrenakwsdgtpvtahdfvyswqrladpntaspyasylqyghian
iddiiagkkpatdlgvkalddhtfevtlsepvpyfykllvhpsvspvpksavekfgdkwt
qpanivtngayklknwvvnerivlernpqywdnaktvinqvtylpissevtdvnryrsge
idmtynnmpielfqklkkeipnevrvdpylctyyyeinnqkapfndvrvrtalklaldrd
iivnkvknqgdlpaysytppytdgaklvepewfkwsqqkrneeakkllaeagftadkplt
fdllyntsdlhkklaiavasiwkknlgvnvnlenqewktfldtrhqgtfdvaragwcady
neptsflntmlsdssnntahykspafdkliadtlkvaddtqrselyakaeqqldkdsaiv
pvyyyvnarlvkpwvggytgkdpldniyvknlyiikh

Timeline for d1jeva_:

• d1jeva_ first appeared (with stable ids) in SCOP 1.55
  
• d1jeva_ appears in SCOP 1.67
  
• d1jeva_ appears in SCOP 1.71
  
• d1jeva_ appears in the current release, SCOPe 2.08