SCOPe 2.07: Domain d6g5ja_: 6g5j A:

Lineage for d6g5ja_ (6g5j A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Phospholipase A2 [48637] (5 species)

7. Species Human (Homo sapiens), SPLA2 [TaxId:9606] [74797] (5 PDB entries)
   group X secretory phospholipase A2

8. Domain d6g5ja_: 6g5j A: [357038]
   automated match to d1le6a_
   complexed with ca, dms, em8, peg

Details for d6g5ja_

PDB Entry: 6g5j, 1.85 Å

PDB Description: secreted phospholipase a2 type x in complex with ligand

PDB Compounds: (A:) group 10 secretory phospholipase a2

SCOPe Domain Sequences for d6g5ja_:

Sequence; same for both SEQRES and ATOM records:

>d6g5ja_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]}
gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
kc

Timeline for d6g5ja_:

• d6g5ja_ is new in SCOPe 2.07-stable
  
• d6g5ja_ appears in the current release, SCOPe 2.08