SCOPe 2.02: Domain d1lbgb2: 1lbg B:61-357

Lineage for d1lbgb2 (1lbg B:61-357)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)

6. Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)

7. Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)

8. Domain d1lbgb2: 1lbg B:61-357 [35703]
   Other proteins in same PDB: d1lbga1, d1lbgb1, d1lbgc1, d1lbgd1
   protein/DNA complex

Details for d1lbgb2

PDB Entry: 1lbg, 4.8 Å

PDB Description: lactose operon repressor bound to 21-base pair symmetric operator dna, alpha carbons only

PDB Compounds: (B:) protein (lactose operon repressor)

SCOPe Domain Sequences for d1lbgb2:

Sequence; same for both SEQRES and ATOM records:

>d1lbgb2 c.93.1.1 (B:61-357) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle

Timeline for d1lbgb2:

• d1lbgb2 first appeared (with stable ids) in SCOP 1.55
  
• d1lbgb2 appears in SCOPe 2.01
  
• d1lbgb2 appears in SCOPe 2.03
  
• d1lbgb2 appears in the current release, SCOPe 2.08