Lineage for d1lbid_ (1lbi D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520441Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 2520442Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)
  8. 2520457Domain d1lbid_: 1lbi D: [35697]

Details for d1lbid_

PDB Entry: 1lbi (more details), 2.7 Å

PDB Description: lac repressor
PDB Compounds: (D:) lac repressor

SCOPe Domain Sequences for d1lbid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbid_ c.93.1.1 (D:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrle

SCOPe Domain Coordinates for d1lbid_:

Click to download the PDB-style file with coordinates for d1lbid_.
(The format of our PDB-style files is described here.)

Timeline for d1lbid_: