Lineage for d1efac2 (1efa C:61-331)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008365Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1008366Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1008367Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1008469Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 1008470Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)
  8. 1008480Domain d1efac2: 1efa C:61-331 [35693]
    Other proteins in same PDB: d1efaa1, d1efab1, d1efac1
    protein/DNA complex; complexed with npf

Details for d1efac2

PDB Entry: 1efa (more details), 2.6 Å

PDB Description: crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf
PDB Compounds: (C:) lac repressor

SCOPe Domain Sequences for d1efac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efac2 c.93.1.1 (C:61-331) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttla

SCOPe Domain Coordinates for d1efac2:

Click to download the PDB-style file with coordinates for d1efac2.
(The format of our PDB-style files is described here.)

Timeline for d1efac2: