Lineage for d1tlfc_ (1tlf C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185128Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1185129Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1185130Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1185232Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 1185233Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)
  8. 1185239Domain d1tlfc_: 1tlf C: [35689]
    complexed with emc, ipt

Details for d1tlfc_

PDB Entry: 1tlf (more details), 2.6 Å

PDB Description: unprecedented quaternary structure of e. coli lac repressor core tetramer: implications for dna looping
PDB Compounds: (C:) lac repressor

SCOPe Domain Sequences for d1tlfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlfc_ c.93.1.1 (C:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrl

SCOPe Domain Coordinates for d1tlfc_:

Click to download the PDB-style file with coordinates for d1tlfc_.
(The format of our PDB-style files is described here.)

Timeline for d1tlfc_: