Lineage for d2puea2 (2pue A:59-340)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186118Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 186119Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 186120Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)
  6. 186212Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)
  7. 186213Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)
  8. 186221Domain d2puea2: 2pue A:59-340 [35682]
    Other proteins in same PDB: d2puea1

Details for d2puea2

PDB Entry: 2pue (more details), 2.7 Å

PDB Description: crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices

SCOP Domain Sequences for d2puea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2puea2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgpleqntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

SCOP Domain Coordinates for d2puea2:

Click to download the PDB-style file with coordinates for d2puea2.
(The format of our PDB-style files is described here.)

Timeline for d2puea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2puea1