Lineage for d1zaya2 (1zay A:59-340)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 250599Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 250600Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 250601Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)
  6. 250693Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)
  7. 250694Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)
  8. 250701Domain d1zaya2: 1zay A:59-340 [35681]
    Other proteins in same PDB: d1zaya1

Details for d1zaya2

PDB Entry: 1zay (more details), 2.7 Å

PDB Description: purine repressor-hypoxanthine-modified-purf-operator complex

SCOP Domain Sequences for d1zaya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zaya2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

SCOP Domain Coordinates for d1zaya2:

Click to download the PDB-style file with coordinates for d1zaya2.
(The format of our PDB-style files is described here.)

Timeline for d1zaya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zaya1