SCOP 1.61: Domain d2puda2: 2pud A:59-340

Lineage for d2puda2 (2pud A:59-340)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)

6. Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)

7. Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)

8. Domain d2puda2: 2pud A:59-340 [35678]
   Other proteins in same PDB: d2puda1

Details for d2puda2

PDB Entry: 2pud, 2.6 Å

PDB Description: crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices

SCOP Domain Sequences for d2puda2:

Sequence; same for both SEQRES and ATOM records:

>d2puda2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgpleantgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

Timeline for d2puda2:

• d2puda2 first appeared (with stable ids) in SCOP 1.55
  
• d2puda2 appears in SCOP 1.59
  
• d2puda2 appears in SCOP 1.63
  
• d2puda2 appears in the current release, SCOPe 2.08