Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries) |
Domain d6gf1b1: 6gf1 B:7-81 [356771] Other proteins in same PDB: d6gf1a2, d6gf1b2, d6gf1c2 automated match to d2mbea_ complexed with so4 |
PDB Entry: 6gf1 (more details), 1.93 Å
SCOPe Domain Sequences for d6gf1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gf1b1 d.15.1.0 (B:7-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} vhvrseewdlmtfdanpydsvkkikehvrsktkvpvqdqvlllgskilkprrslssygid kektihltlkvvkps
Timeline for d6gf1b1:
View in 3D Domains from other chains: (mouse over for more information) d6gf1a1, d6gf1a2, d6gf1c1, d6gf1c2 |