Lineage for d6gf1b1 (6gf1 B:7-81)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540283Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)
  8. 2540372Domain d6gf1b1: 6gf1 B:7-81 [356771]
    Other proteins in same PDB: d6gf1a2, d6gf1b2, d6gf1c2
    automated match to d2mbea_
    complexed with so4

Details for d6gf1b1

PDB Entry: 6gf1 (more details), 1.93 Å

PDB Description: the structure of the ubiquitin-like modifier fat10 reveals a novel targeting mechanism for degradation by the 26s proteasome
PDB Compounds: (B:) Ubiquitin D

SCOPe Domain Sequences for d6gf1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gf1b1 d.15.1.0 (B:7-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vhvrseewdlmtfdanpydsvkkikehvrsktkvpvqdqvlllgskilkprrslssygid
kektihltlkvvkps

SCOPe Domain Coordinates for d6gf1b1:

Click to download the PDB-style file with coordinates for d6gf1b1.
(The format of our PDB-style files is described here.)

Timeline for d6gf1b1: