Lineage for d6gtaa1 (6gta A:1-177)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391750Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2391751Protein automated matches [226849] (8 species)
    not a true protein
  7. 2391881Species Thermotoga maritima [TaxId:243274] [356449] (5 PDB entries)
  8. 2391886Domain d6gtaa1: 6gta A:1-177 [356492]
    Other proteins in same PDB: d6gtaa2, d6gtaa3
    automated match to d1zy9a1
    complexed with f9w, mg, so4; mutant

Details for d6gtaa1

PDB Entry: 6gta (more details), 2.2 Å

PDB Description: alpha-galactosidase mutant d378a from thermotoga maritima in complex with intact cyclohexene-based carbasugar mimic of galactose with 3,5 difluorophenyl leaving group
PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d6gtaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gtaa1 b.30.5.0 (A:1-177) automated matches {Thermotoga maritima [TaxId: 243274]}
meifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkapekvlvn
nwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvygflsski
ahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgmenna

SCOPe Domain Coordinates for d6gtaa1:

Click to download the PDB-style file with coordinates for d6gtaa1.
(The format of our PDB-style files is described here.)

Timeline for d6gtaa1: