Class b: All beta proteins [48724] (178 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (8 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [356449] (5 PDB entries) |
Domain d6gtaa1: 6gta A:1-177 [356492] Other proteins in same PDB: d6gtaa2, d6gtaa3 automated match to d1zy9a1 complexed with f9w, mg, so4; mutant |
PDB Entry: 6gta (more details), 2.2 Å
SCOPe Domain Sequences for d6gtaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gtaa1 b.30.5.0 (A:1-177) automated matches {Thermotoga maritima [TaxId: 243274]} meifgktfregrfvlkeknftvefavekihlgwkisgrvkgspgrlevlrtkapekvlvn nwqswgpcrvvdafsfkppeidpnwrytasvvpdvlernlqsdyfvaeegkvygflsski ahpffavedgelvayleyfdvefddfvpleplvvledpntplllekyaelvgmenna
Timeline for d6gtaa1: