Lineage for d1mioc_ (1mio C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912424Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2912425Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 2912490Species Clostridium pasteurianum [TaxId:1501] [81396] (4 PDB entries)
  8. 2912498Domain d1mioc_: 1mio C: [35603]
    Other proteins in same PDB: d1miob_, d1miod_
    complexed with ca, cfm, clp, hca

Details for d1mioc_

PDB Entry: 1mio (more details), 3 Å

PDB Description: x-ray crystal structure of the nitrogenase molybdenum-iron protein from clostridium pasteurianum at 3.0 angstroms resolution
PDB Compounds: (C:) nitrogenase molybdenum iron protein (alpha chain)

SCOPe Domain Sequences for d1mioc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mioc_ c.92.2.3 (C:) Nitrogenase iron-molybdenum protein, alpha chain {Clostridium pasteurianum [TaxId: 1501]}
senlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgv
vmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvn
klkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvs
qsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatlt
gdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmak
cfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvd
slvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkag
vplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskql
hsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasses

SCOPe Domain Coordinates for d1mioc_:

Click to download the PDB-style file with coordinates for d1mioc_.
(The format of our PDB-style files is described here.)

Timeline for d1mioc_: