SCOPe 2.07: Domain d6c7ia1: 6c7i A:579-917

Lineage for d6c7ia1 (6c7i A:579-917)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d6c7ia1: 6c7i A:579-917 [356003]
   Other proteins in same PDB: d6c7ia2, d6c7ib2
   automated match to d5vp0b_
   complexed with ep7, mg, zn

Details for d6c7ia1

PDB Entry: 6c7i, 1.71 Å

PDB Description: crystal structure of human phosphodiesterase 2a with 1-(2-chloro-5- methoxy-phenyl)-n-isobutyl-4-methyl-[1,2,4]triazolo[4,3- a]quinoxaline-8-carboxamide

PDB Compounds: (A:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d6c7ia1:

Sequence; same for both SEQRES and ATOM records:

>d6c7ia1 a.211.1.0 (A:579-917) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddeytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcpt
larfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdl
dhrgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrml
dlmrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkt
trkiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlf
pkaaelyervasnrehwtkvshkftirglpsnnsldfld

Timeline for d6c7ia1:

• d6c7ia1 is new in SCOPe 2.07-stable
  
• d6c7ia1 appears in the current release, SCOPe 2.08