Lineage for d6g7xf_ (6g7x F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889092Species Helicobacter pylori [TaxId:85962] [227827] (10 PDB entries)
  8. 2889114Domain d6g7xf_: 6g7x F: [355867]
    automated match to d5lu0a_
    complexed with imd, po4

Details for d6g7xf_

PDB Entry: 6g7x (more details), 1.76 Å

PDB Description: crystal structure of h. pylori purine nucleoside phosphorylase soaked in po4
PDB Compounds: (F:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d6g7xf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g7xf_ c.56.2.0 (F:) automated matches {Helicobacter pylori [TaxId: 85962]}
mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms

SCOPe Domain Coordinates for d6g7xf_:

Click to download the PDB-style file with coordinates for d6g7xf_.
(The format of our PDB-style files is described here.)

Timeline for d6g7xf_: