Lineage for d6g7xa_ (6g7x A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. Protein automated matches [190781] (46 species)
    not a true protein
  7. Species Helicobacter pylori [TaxId:85962] [227827] (10 PDB entries)
  8. Domain d6g7xa_: 6g7x A: [355927]
    automated match to d5lu0a_
    complexed with imd, po4

Details for d6g7xa_

PDB Entry: 6g7x (more details), 1.7600000000000002 Å

PDB Description: crystal structure of h. pylori purine nucleoside phosphorylase soaked in po4
PDB Compounds: (A:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d6g7xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g7xa_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms

SCOPe Domain Coordinates for d6g7xa_ are not available.

Timeline for d6g7xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6g7xb_, d6g7xc_, d6g7xd_, d6g7xe_, d6g7xf_