SCOP 1.65: Domain d6pfkb_: 6pfk B:

Lineage for d6pfkb_ (6pfk B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.89: Phosphofructokinase [53783] (1 superfamily)
   consists of two non-similar domains, 3 layers (a/b/a) each
   Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
   Domain 2 has parallel sheet of 4 strands, order 2314

4. Superfamily c.89.1: Phosphofructokinase [53784] (1 family)

5. Family c.89.1.1: Phosphofructokinase [53785] (2 proteins)

6. Protein ATP-dependent phosphofructokinase [53786] (2 species)
   Domain 1 binds ATP

7. Species Bacillus stearothermophilus [TaxId:1422] [53788] (4 PDB entries)

8. Domain d6pfkb_: 6pfk B: [35584]

Details for d6pfkb_

PDB Entry: 6pfk, 2.6 Å

PDB Description: phosphofructokinase, inhibited t-state

SCOP Domain Sequences for d6pfkb_:

Sequence; same for both SEQRES and ATOM records:

>d6pfkb_ c.89.1.1 (B:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus}
mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgieglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialws
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi

Timeline for d6pfkb_:

• d6pfkb_ first appeared (with stable ids) in SCOP 1.55
  
• d6pfkb_ appears in SCOP 1.63
  
• d6pfkb_ appears in SCOP 1.67
  
• d6pfkb_ appears in the current release, SCOPe 2.08