Lineage for d6pfkb_ (6pfk B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27922Fold c.89: Phosphofructokinase [53783] (1 superfamily)
  4. 27923Superfamily c.89.1: Phosphofructokinase [53784] (1 family) (S)
  5. 27924Family c.89.1.1: Phosphofructokinase [53785] (1 protein)
  6. 27925Protein Phosphofructokinase [53786] (2 species)
  7. 27926Species Bacillus stearothermophilus [TaxId:1422] [53788] (3 PDB entries)
  8. 27930Domain d6pfkb_: 6pfk B: [35584]

Details for d6pfkb_

PDB Entry: 6pfk (more details), 2.6 Å

PDB Description: phosphofructokinase, inhibited t-state

SCOP Domain Sequences for d6pfkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfkb_ c.89.1.1 (B:) Phosphofructokinase {Bacillus stearothermophilus}
mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgieglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialws
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi

SCOP Domain Coordinates for d6pfkb_:

Click to download the PDB-style file with coordinates for d6pfkb_.
(The format of our PDB-style files is described here.)

Timeline for d6pfkb_: