Lineage for d6gmne_ (6gmn E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945444Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2945540Protein Elongin C [54699] (3 species)
  7. 2945543Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries)
  8. 2945564Domain d6gmne_: 6gmn E: [355762]
    Other proteins in same PDB: d6gmna_, d6gmnc_, d6gmnd_, d6gmnf_, d6gmng_, d6gmni_, d6gmnj_, d6gmnk2, d6gmnl_
    automated match to d1lm8c_
    complexed with act, f4e

Details for d6gmne_

PDB Entry: 6gmn (more details), 1.94 Å

PDB Description: pvhl:elob:eloc in complex with methyl 4h-furo[3,2-b]pyrrole-5- carboxylate
PDB Compounds: (E:) Elongin-C

SCOPe Domain Sequences for d6gmne_:

Sequence, based on SEQRES records: (download)

>d6gmne_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d6gmne_ d.42.1.1 (E:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d6gmne_:

Click to download the PDB-style file with coordinates for d6gmne_.
(The format of our PDB-style files is described here.)

Timeline for d6gmne_: