Lineage for d6gmnc_ (6gmn C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768806Domain d6gmnc_: 6gmn C: [355734]
    Other proteins in same PDB: d6gmna_, d6gmnb_, d6gmnd_, d6gmne_, d6gmng_, d6gmnh_, d6gmnj_, d6gmnk1, d6gmnk2
    automated match to d1lqbc_
    complexed with act, f4e

Details for d6gmnc_

PDB Entry: 6gmn (more details), 1.94 Å

PDB Description: pvhl:elob:eloc in complex with methyl 4h-furo[3,2-b]pyrrole-5- carboxylate
PDB Compounds: (C:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d6gmnc_:

Sequence, based on SEQRES records: (download)

>d6gmnc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerl

Sequence, based on observed residues (ATOM records): (download)

>d6gmnc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvpifanitlpvytlkerclqvvrslvkpenyrrldivrsl
yedledhpnvqkdlerl

SCOPe Domain Coordinates for d6gmnc_:

Click to download the PDB-style file with coordinates for d6gmnc_.
(The format of our PDB-style files is described here.)

Timeline for d6gmnc_: