Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Thermus scotoductus [TaxId:743525] [355536] (1 PDB entry) |
Domain d5ogtb_: 5ogt B: [355665] automated match to d3hgja_ complexed with fmn; mutant |
PDB Entry: 5ogt (more details), 2.3 Å
SCOPe Domain Sequences for d5ogtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ogtb_ c.1.4.0 (B:) automated matches {Thermus scotoductus [TaxId: 743525]} allftplelgglrlknrlamspmdqysatlegevtdwhllhyptralggvglilveatav eplgrtspydlgiwsedhlpglkelarrireagavpgiqlhhagrkagtarpweggkplg wrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgyllss flsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsledt lafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittpe qaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf
Timeline for d5ogtb_: