Lineage for d5zaic_ (5zai C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462140Species Metallosphaera sedula [TaxId:399549] [355600] (1 PDB entry)
  8. 2462143Domain d5zaic_: 5zai C: [355612]
    automated match to d2qq3c_
    complexed with coa, edo, gol

Details for d5zaic_

PDB Entry: 5zai (more details), 1.8 Å

PDB Description: crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula
PDB Compounds: (C:) 3-hydroxypropionyl-coenzyme A dehydratase

SCOPe Domain Sequences for d5zaic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zaic_ c.14.1.0 (C:) automated matches {Metallosphaera sedula [TaxId: 399549]}
mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
kkegvsaflekreptfkgk

SCOPe Domain Coordinates for d5zaic_:

Click to download the PDB-style file with coordinates for d5zaic_.
(The format of our PDB-style files is described here.)

Timeline for d5zaic_: