Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (70 species) not a true protein |
Species Metallosphaera sedula [TaxId:399549] [355600] (1 PDB entry) |
Domain d5zaic_: 5zai C: [355612] automated match to d2qq3c_ complexed with coa, edo, gol |
PDB Entry: 5zai (more details), 1.8 Å
SCOPe Domain Sequences for d5zaic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zaic_ c.14.1.0 (C:) automated matches {Metallosphaera sedula [TaxId: 399549]} mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted kkegvsaflekreptfkgk
Timeline for d5zaic_: