SCOPe 2.07: Domain d5ow8b_: 5ow8 B:

Lineage for d5ow8b_ (5ow8 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Phospholipase A2 [48637] (5 species)

7. Species Human (Homo sapiens), SPLA2 [TaxId:9606] [74797] (5 PDB entries)
   group X secretory phospholipase A2

8. Domain d5ow8b_: 5ow8 B: [355559]
   automated match to d1le6a_
   complexed with ayn, ca, cl, dms, peg

Details for d5ow8b_

PDB Entry: 5ow8, 1.9 Å

PDB Description: indole-2 carboxamides as selective secreted phospholipase a2 type x (spla2-x) inhibitors

PDB Compounds: (B:) group 10 secretory phospholipase a2

SCOPe Domain Sequences for d5ow8b_:

Sequence; same for both SEQRES and ATOM records:

>d5ow8b_ a.133.1.2 (B:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]}
gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
kcd

Timeline for d5ow8b_:

• d5ow8b_ is new in SCOPe 2.07-stable
  
• d5ow8b_ appears in the current release, SCOPe 2.08